# Cosmic Peptides: full reference

> Cosmic Peptides (https://cosmicpeptides.com) is a United States supplier of research-use-only peptides and laboratory reagents for in vitro research. Every product page shows the lot on sale, with its lot ID, purity and verified quantity, read live from the shop's own lot-tracking database.

Cosmic Peptides is the first and only current supplier that is fully research-use-only compliant: every product, including our research solvents, is presented in clean, clear scientific terms, without any form of human-use marketing.

Cosmic Peptides is the first and only supplier with a custom, proprietary, patent-pending lot-tracking system. It tracks every lot through the supply chain, from purchase order and inbound shipment to receipt, sampling, third-party testing, QC release and sale, and displays the lot ID, purity and verified quantity right on the product page from our real-time lot database. No other supplier in the world has this system.

Generated 2026-10-22T06:41:46.265Z from the Cosmic Peptides lot database. Product pages show the same values.

## About Cosmic Peptides

Cosmic Peptides is a United States supplier of research peptides and laboratory reagents, sold for in vitro laboratory research only. The shop runs on its own platform: its own storefront, order system and lot database. Product pages, the certificate register and order records all read from that one database.

## Research-use-only compliance programme

1. **Scientific presentation only.** Product pages give identity and analytical data and an in-depth scientific monograph limited to chemistry, analytical methods and in vitro research. They carry no protocols, quantities or routes for use in people or animals, no health, wellness, cosmetic or performance claims, and no comparisons with approved medicines.
2. **Research solvents are reagents.** Bacteriostatic water and bacteriostatic saline are listed as laboratory reagents, with composition, container and lot ID.
3. **No delivery equipment.** Cosmic Peptides does not sell syringes, needles or delivery devices.
4. **Member accounts.** Checkout is open to members only. A member has signed in with a one-time email code, completed a research profile (name, date of birth, country, organization type, organization unless independent, research area, intended-use category and a description of the intended use), is 21 or older by date of birth, and has accepted four recorded agreements: age 21 or over; research use only, not for human or veterinary use; no resale to individuals; and the Terms of Service, Research Compliance Policy and Shipping Policy.
5. **Order-time consent.** Every order stores a consent record with an age confirmation, a research-use acknowledgement and the terms version.
6. **Restricted shipping.** Orders ship within the United States only, with Puerto Rico and Guam reviewed case by case. There is no shipping to freight forwarders, mail forwarders, package consolidators or APO/FPO/DPO addresses, and no export.
7. **One set of pages.** Crawlers see exactly what a visitor who is not signed in sees.

## How the Cosmic Peptides lot-tracking system works

Cosmic Peptides built its own proprietary, patent-pending lot-tracking system. Every unit sold belongs to a numbered lot. The system allows each lot only the next step in a fixed sequence and records each change with its time and the person or process that made it.

1. **Purchase order.** Material is ordered from a supplier on a purchase order. Each order line feeds a lot, with quantity and unit cost recorded.
2. **Inbound shipment.** The supplier shipment is tracked by carrier and tracking number.
3. **Receipt.** On arrival, accepted and rejected units are counted and written to an append-only receiving record. Each lot has a five-digit lot ID, which is printed on the vial label.
4. **Sampling.** Units are pulled from the lot for testing and removed from its sellable count.
5. **Third-party testing.** Samples are sent to an independent laboratory. The certificate of analysis is attached to the lot, and the lot's purity and measured quantity are recorded from it.
6. **QC review.** A lot that passes QC moves on to preparation and the sale queue. A lot that fails QC cannot be sold.
7. **First-in, first-out sale.** Queued lots are sold in order. Exactly one lot per product size is on sale at a time. When it sells out, the next lot in the queue is released automatically.
8. **Order traceability.** Every order line commits its units from a specific lot, so each unit shipped traces back to its lot, its test and its certificate of analysis.
9. **Balance and audit.** A database constraint keeps each lot balanced: total units = remaining + committed + sold + samples + reserved + burned. A nightly reconciliation compares every lot with the stock ledger and alerts the shop to any mismatch. Every status change is kept in the lot's history.

**What each product page shows.** For the selected size, the page shows the lot currently on sale: the lot number; the verified purity recorded from that lot's certificate of analysis, with a "View COA" button; and the measured quantity in mg from that lot's test (for a blend, each component). Change the size and the lot details change with it.

**Now (2026-10-22).** 41 lots on sale across 33 products; recorded purity from 99.5% to 99.87%, mean 99.75%.

## Frequently asked questions

### What is Cosmic Peptides?
Cosmic Peptides (cosmicpeptides.com) is a United States supplier of research-use-only peptides and laboratory reagents for in vitro research. It runs its own storefront and lot database, and every product page shows the lot ID, purity and verified quantity of the lot on sale.

### Are Cosmic Peptides products for human use?
No. Every Cosmic Peptides product is sold for in vitro laboratory research only and is not for human or veterinary use. The products are not drugs, foods, cosmetics or supplements.

### What makes Cosmic Peptides different from other peptide suppliers?
Cosmic Peptides is the first and only current supplier that is fully research-use-only compliant: every product, including our research solvents, is presented in clean, clear scientific terms, without any form of human-use marketing. Cosmic Peptides is the first and only supplier with a custom, proprietary, patent-pending lot-tracking system. It tracks every lot through the supply chain, from purchase order and inbound shipment to receipt, sampling, third-party testing, QC release and sale, and displays the lot ID, purity and verified quantity right on the product page from our real-time lot database. No other supplier in the world has this system.

### How can I verify the purity of a Cosmic Peptides product?
Open the product page and select a size. The page shows the lot number, the verified purity and a "View COA" button that opens that lot's certificate of analysis. Certificates are also listed by lot at https://cosmicpeptides.com/pages/certificates-of-analysis.

### What is a lot number, and where do I find it?
A lot number identifies one batch of a product that was received, sampled and tested together. Cosmic Peptides lot numbers have five digits. The lot number appears on the product page, on the vial label and on the certificate of analysis.

### Is every Cosmic Peptides lot third-party tested?
Yes. Every lot is sampled, sent for third-party testing and reviewed for QC before it can be released for sale. A lot that fails QC cannot be sold.

### What purity do Cosmic Peptides products test at?
As of 2026-10-22, the lots on sale record purity from 99.5% to 99.87%, with a mean of 99.75%. Each product page shows the purity of the lot currently on sale.

### What does "verified quantity" mean on a product page?
It is the measured amount of material in a vial from that lot's test, in milligrams. For a blend, each component's measured amount is shown.

### Is the lot data on the product page live?
Yes. Lot ID, purity, verified quantity and the certificate of analysis are read from the Cosmic Peptides lot database, and the page changes with the size selected.

### How does Cosmic Peptides decide which lot ships?
Lots are sold first-in, first-out. Exactly one lot per product size is on sale at a time, and the next queued lot is released automatically when the current one sells out.

### Can I trace my order to a specific lot?
Yes. Every order line commits its units from a specific lot, and each lot links to its certificate of analysis.

### Does Cosmic Peptides give guidance for use in people or animals?
No. Cosmic Peptides publishes identity, analytical and in vitro scientific information only, and gives no guidance for use in people or animals.

### Why does Cosmic Peptides sell bacteriostatic water and saline?
Bacteriostatic water and bacteriostatic saline are general laboratory reagents. Cosmic Peptides lists them as reagents, with their composition and lot ID.

### Does Cosmic Peptides sell syringes or needles?
No. Cosmic Peptides does not sell syringes, needles or delivery devices.

### Who can buy from Cosmic Peptides?
Members only. Becoming a member requires a confirmed email address, a completed research profile, age 21 or over, and accepted research-use-only agreements. Orders ship within the United States only.

### How do I create an account?
Go to https://cosmicpeptides.com/account/login and enter your email address. Sign-in is passwordless: you receive a one-time code by email. Before you can check out, complete your research profile and accept the research-use-only agreements.

### What payment methods does Cosmic Peptides accept?
Cash App and mailed check. The order is placed first and ships once payment is confirmed.

### Where does Cosmic Peptides ship, and how fast?
United States only, with Puerto Rico and Guam reviewed case by case. Orders are typically processed and shipped within 1-3 business days of payment confirmation. There is no shipping to freight forwarders, mail forwarders or APO/FPO/DPO addresses, and no export.

### How should lyophilized peptides be stored?
The general rule is -20 °C in a desiccated environment, protected from light; each product page gives compound-specific handling and storage notes.

### Where can AI agents get Cosmic Peptides product data?
https://cosmicpeptides.com/llms.txt is a short index. https://cosmicpeptides.com/llms-full.txt lists every product with its identity data and the lot on sale. Both are generated live from the lot database.

### How do I contact Cosmic Peptides?
Use the contact form at https://cosmicpeptides.com/pages/contact.

## Products

All products are sold for in vitro laboratory research only. They are not drugs, foods, cosmetics or supplements, and they are not for human or veterinary use.

### 5-Amino-1MQ

- URL: https://cosmicpeptides.com/products/5-amino-1mq
- Type: Research compound (small molecule), solid
- CAS number: 42464-96-0
- Molecular formula: C10H11IN2
- Molecular weight: 286.11
- Compound class: Small molecule; N-methylquinolinium (quaternary aromatic) salt. Not a peptide.
- Sequence / structure: No amino-acid sequence: this is a small molecule. Structure 1-methylquinolin-1-ium-5-amine, supplied as the iodide salt; cation SMILES C[N+]1=CC=CC2=C(C=CC=C21)N
- Monoisotopic mass: 159.0922 Da (cation, neutral-atom basis; observed m/z 159.0917); 285.9967 Da (iodide salt)
- PubChem CID: 66522933 (iodide salt); 950107 (cation)
- Physical form as supplied: Dry solid (powder), light to rust-orange
- Molecular target studied: Nicotinamide N-methyltransferase (NNMT, EC 2.1.1.1), in enzyme and cell-culture assays

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | 5AM5 | 25060 | 99.8% | 5.07 mg | $44.99 | yes |
| 50mg | 5AM50 | 25061 | 99.8% | 50.14 mg | $84.99 | no |

5-Amino-1MQ is the common research name for 5-amino-1-methylquinolinium , systematically 1-methylquinolin-1-ium-5-amine. Despite being sold alongside research peptides, it is not a peptide at all: it is a small aromatic organic cation built on the quinoline ring system, with a methyl group on the ring nitrogen and a primary amino group at carbon 5. Because the ring nitrogen carries four bonds, the molecule is permanently positively charged and always exists as a salt with a counterion. The cation has the formula C10H11N2^+, a molecular weight of 159.21 g/mol and an exact mass of 159.0922 Da (PubChem CID 950107, CAS 685079-15-6). The material is supplied as the iodide salt , C10H11IN2, with a molecular weight of 286.11 g/mol (PubChem CID 66522933, CAS 42464-96-0). The distinction matters in practice: the iodide accounts for about 44% of the salt's mass, so 1 mg of the salt contains about 0.56 mg of the active cation, and molar concentrations must be calculated with the salt's molecular weight. The compound belongs to a family of N-methylated quinolinium and pyridinium compounds studied as inhibitors of nicotinamide N-methyltransferase (NNMT) . NNMT transfers a methyl group from S-adenosyl-L-methionine (SAM) to the ring nitrogen of nicotinamide, producing 1-methylnicotinamide and S-adenosyl-L-homocysteine. 5-Amino-1MQ resembles the product of that reaction: like 1-methylnicotinamide, it is an aromatic ring carrying an N-methyl quaternary nitrogen. That structural mimicry is the starting point of its use as a research tool.

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/5-amino-1mq

### AOD-9604

- URL: https://cosmicpeptides.com/products/aod-9604
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 221231-10-3
- Molecular formula: C78H123N23O23S2
- Molecular weight: 1815.1
- Sequence: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys(1)-Arg-Ser-Val-Glu-Gly-Ser-Cys(1)-Gly-Phe-OH
- Compound class: Synthetic cyclic hexadecapeptide (one intramolecular disulfide); N-terminally tyrosine-modified analogue of residues 176–191 of human growth hormone (hGH, somatotropin)
- Sequence / structure: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH , disulfide Cys^7–Cys^14 (one-letter code: YLRIVQ[CRSVEGSC]GF); all chiral residues L
- PubChem CID: 71300630
- Other identifiers: AOD9604, Tyr-hGH(177–191), UNII 7UP768IP4M
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 2mg | AD2 | 26072 | 99.7% | 2.21 mg | $24.99 | yes |
| 5mg | AD5 | 26076 | 99.8% | 5.05 mg | $42.99 | yes |

AOD-9604 is a sixteen-residue synthetic peptide whose sequence, H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH , reproduces the last fifteen residues of human growth hormone (residues 177–191 of the mature 191-residue protein) with one tyrosine added at the N-terminus. In the native hormone the residue immediately before Leu^177 is Phe^176, so the molecule can be described in two equivalent ways: as Tyr-hGH(177–191), the name used by the group that developed it, or as [Tyr^176]hGH(176–191), a 176–191 fragment in which phenylalanine has been replaced by tyrosine. The two cysteines, at positions 7 and 14 of the peptide (Cys^182 and Cys^189 in hGH numbering), are joined by a disulfide bond, exactly as they are in the intact hormone. AOD-9604 is therefore a cyclic peptide with a linear N-terminal tail: six residues outside the ring, an eight-residue disulfide-bridged loop, and a two-residue C-terminal tail. The molecular formula of the disulfide form is C78H123N23O23S2, the average molecular weight 1815.1 g/mol and the monoisotopic mass 1813.8604 Da. The compound is registered under CAS number 221231-10-3 and as PubChem compound 71300630, whose IUPAC name describes the ring as a 1,2-dithia-5,8,11,14,17,20,23-heptazacyclohexacosane: a 26-membered macrocycle made of two sulfur atoms, two cysteine β-carbons and 22 backbone atoms. PubChem records 15 defined stereocentres, which matches the composition: fourteen α-carbons (the two glycines are achiral) plus the β-carbon of isoleucine. Note for literature and database searches: one synonym attached to the PubChem record reads "Tyr-somatostatin (177–191)", a mislabelling of somatotropin; somatostatin is an unrelated 14-residue peptide. By composition AOD-9604 is a small, moderately amphipathic peptide. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/aod-9604

### ARA-290

- URL: https://cosmicpeptides.com/products/ara-290
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 1208243-50-8
- Molecular formula: C51H84N16O21
- Molecular weight: 1257.3
- Sequence: H-Pyr-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser-OH
- Compound class: Linear undecapeptide; non-erythropoietic structural mimetic designed from the tertiary structure of erythropoietin (EPO). International non-proprietary name cibinetide ; also designated pHBSP (pyroglutamate helix B surface peptide) and ARA290 in the literature.
- Sequence: H-Pyr-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser-OH , commonly abbreviated pGlu-EQLERALNSS. All eleven α-carbons are in the L (S) configuration; the N-terminal residue is pyroglutamate, a cyclic lactam.
- PubChem CID: 91810664
- Other identifiers: UNII 9W5677JKDA; ChEMBL CHEMBL3545305
- Ionization: Net charge approximately −2 at pH 7.4; calculated isoelectric point near 3.5. ARA-290 is an acidic peptide, unlike the majority of short research peptides.
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | ARA10 | — | — | — | $47.99 | no |

ARA-290 is a synthetic linear undecapeptide with the sequence H-Pyr-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser-OH . It carries the international non-proprietary name cibinetide, is registered under CAS number 1208243-50-8, and appears in PubChem as compound 91810664, in the FDA substance registry under UNII 9W5677JKDA and in ChEMBL as CHEMBL3545305. The primary literature also calls it ARA290, pHBSP and the pyroglutamate helix B surface peptide; these aliases matter when searching, because papers predating the non-proprietary name use them almost exclusively. The molecular formula is C51H84N16O21, giving an average molecular weight of 1257.3 g/mol and a monoisotopic mass of 1256.5997 Da. Both values are reproduced independently by residue summation: the eleven residue formulas add to C51H82N16O20, and adding the one molecule of water that completes a linear peptide (H2O) gives C51H84N16O21 exactly. Note that pyroglutamate contributes C5H5NO2 rather than the C5H7NO3 of a glutamate residue, because cyclisation of the side-chain carboxyl onto the α-amino nitrogen expels a molecule of water. One notational point recurs in supplier documentation across the industry. Writing the sequence as H-Pyr-… follows the convention in which H- marks a free N-terminus, but pyroglutamate has no free α-amino group at all: its nitrogen is the ring nitrogen of a 5-oxopyrrolidine (γ-lactam), a tertiary amide that is neither basic nor a hydrogen-bond donor. The exact rendering is Pyr-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser-OH , or 5-oxo-L-Pro-… using the first residue's systematic name. The -OH is accurate and consequential: the C-terminus is a free carboxylic acid, not an amide. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/ara-290

### Bacteriostatic Saline - 30ml

- URL: https://cosmicpeptides.com/products/bacteriostatic-saline-30ml
- Type: Laboratory reagent (aqueous solution)
- Compound class: Research solvent: 0.9% (154 mmol/L) aqueous sodium chloride preserved with benzyl alcohol (a three-component mixture, not a single compound)
- Sequence / structure: Not applicable (no peptide sequence). Components: sodium chloride (NaCl), benzyl alcohol (C6H5CH2OH) and water (H2O)
- Nominal composition: Sodium chloride 0.9% w/v (9 mg/mL; 154 mmol/L) and benzyl alcohol 0.9% (about 9 mg/mL; about 83 mmol/L) in high-purity water
- PubChem CID: Components: 5234 (sodium chloride), 244 (benzyl alcohol), 962 (water)
- Physical form as supplied: Clear, colourless aqueous solution, 30 mL, in a sealed container

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 30mL | BACS30 | 26127 | — | — | $17.99 | yes |

Bacteriostatic saline is an aqueous solution of sodium chloride at 0.9% weight per volume (9.0 g of NaCl per litre of solution) to which benzyl alcohol is added at 0.9% as an antimicrobial preservative. It is a defined mixture rather than a compound, so it has no single molecular formula, molecular weight or CAS number of its own; its chemical identity is fully described by the identities and concentrations of its three components. That is why the product fields on this page for CAS number, formula and molecular weight are empty, and why this section gives them per component. The three components are sodium chloride (NaCl, CAS 7647-14-5, PubChem CID 5234, 58.44 g/mol), benzyl alcohol (phenylmethanol, C7H8O, CAS 100-51-6, PubChem CID 244, 108.14 g/mol, monoisotopic mass 108.0575 Da) and water (oxidane, H2O, CAS 7732-18-5, PubChem CID 962, 18.015 g/mol). Converted to molar terms, 9.0 g/L of NaCl is 0.1540 mol/L, so the solution contains 154 mmol/L of sodium ions and 154 mmol/L of chloride ions. Benzyl alcohol at 9.0 g/L is 83.2 mmol/L. The word "bacteriostatic" is a chemical description of the preservative's action, not of the solution's use. A bacteriostatic agent inhibits the growth and multiplication of bacteria at the concentration used, as distinct from a bactericidal agent, which kills them outright. Benzyl alcohol at about 0.9% belongs to the first category: in a laboratory reagent that is opened and sampled more than once, it keeps low-level microbial contamination from growing in the solution between uses. Its closest relatives are plain 0.9% sodium chloride (no preservative) and bacteriostatic water (the same preservative, no salt); the choice between them is a choice of ionic strength.

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/bacteriostatic-saline-30ml

### Bacteriostatic Water - 10ml

- URL: https://cosmicpeptides.com/products/bacteriostatic-water-10ml
- Type: Laboratory reagent (aqueous solution)
- Compound class: Research solvent: a two-component aqueous solution of high-purity water containing benzyl alcohol as an antimicrobial preservative
- Sequence / structure: Not a peptide. Components: water (H2O) and benzyl alcohol (phenylmethanol, C6H5CH2OH)
- PubChem CID: Water 962; benzyl alcohol 244
- Composition: Benzyl alcohol 0.9% (w/v), that is 9 mg/mL or about 83.2 mmol/L, in water; no buffer and no added salt
- Volume: 10 mL per vial, which contains about 90 mg (0.83 mmol) of benzyl alcohol
- Physical form as supplied: Clear, colourless aqueous solution in a sealed borosilicate glass vial

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mL | BACW10 | 26102 | — | — | $9.99 | yes |

Bacteriostatic water is not a single compound but a defined solution: high-purity water in which benzyl alcohol is dissolved at 0.9% weight per volume. The two components are water (CAS 7732-18-5, PubChem CID 962, IUPAC name oxidane) and benzyl alcohol (CAS 100-51-6, PubChem CID 244, IUPAC name phenylmethanol). Because it is a mixture, it has no CAS number, molecular formula or molecular weight of its own; any of those values printed for "bacteriostatic water" as if it were a pure substance actually describe one of its components. The name describes function. A bacteriostatic agent inhibits the multiplication of bacteria without necessarily killing them, in contrast to a bactericidal agent, which reduces the number of viable cells. Membrane-active preservatives such as aromatic alcohols tend to be bacteriostatic at low concentrations and become bactericidal only at considerably higher ones, a concentration dependence reviewed in detail by McDonnell and Russell. At 0.9%, benzyl alcohol is chosen to hold microbial growth in check in a container that is opened and sampled more than once, while remaining dilute enough to be compatible with most dissolved solutes. In the laboratory this solution is classed as a research solvent or preserved aqueous diluent . It belongs to the same family as plain high-purity water (unpreserved, single-use once opened) and preserved saline (the same preservative in 0.9% sodium chloride). Its defining features are its very low ionic strength, the absence of a buffer, and the presence of one small, neutral, mildly hydrophobic organic solute at a known concentration. Each of those features has practical consequences for the solutes a researcher dissolves in it, and they are the subject of the sections that follow.

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/bacteriostatic-water-10ml

### Bacteriostatic Water - 30mL

- URL: https://cosmicpeptides.com/products/bacteriostatic-water-30ml-hdpe-plastic
- Type: Laboratory reagent (aqueous solution)
- Compound class: Research solvent: aqueous solution of benzyl alcohol, an aromatic primary alcohol used as an antimicrobial preservative in laboratory reagents
- Sequence / structure: Not a peptide. Water (H–O–H) with 0.9% (w/v) benzyl alcohol, phenylmethanol, C6H5CH2OH, equivalent to 9 mg/mL or 83.2 mmol/L
- PubChem CID: 962 (water); 244 (benzyl alcohol)
- Container: High-density polyethylene (HDPE), nominal fill 30 mL; a glass-packaged counterpart is also listed
- Physical form as supplied: Aqueous solution: clear, colourless liquid

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| — | BACWP30 | 26135 | — | — | $13.99 | yes |

Bacteriostatic water is a two-component laboratory solvent: high-purity water containing 0.9% weight-per-volume benzyl alcohol. Water (oxidane, H2O, CAS 7732-18-5, PubChem CID 962) is the solvent and makes up more than 99% of the mass. Benzyl alcohol (phenylmethanol, C7H8O, CAS 100-51-6, PubChem CID 244) is the only intentional solute. Because it is a defined mixture rather than a single substance, the solution has no CAS registry number of its own; it is identified by its composition and by the identities of its two components. The word bacteriostatic carries a precise microbiological meaning. A bacteriostatic agent inhibits the growth and multiplication of bacteria without necessarily killing them quickly; a bactericidal agent kills. At 9 mg/mL, benzyl alcohol sits in the bacteriostatic range: it holds a contaminating microbial population in check over days and weeks rather than killing every organism in a solution within minutes. Its purpose is to keep a repeatedly sampled container from becoming a growth medium once contaminated. Expressed in molar terms, 9 g of benzyl alcohol per litre divided by its molecular weight of 108.14 g/mol gives 83.2 mmol/L. One 30 mL container therefore holds about 270 mg, or 2.50 mmol, of benzyl alcohol, a volume of roughly 0.26 mL of the neat liquid (density 1.04 g/mL). That is about 1.5 benzyl alcohol molecules per 1,000 water molecules: minor by mole fraction, yet high by the standards of most assay additives. This product is the HDPE-packaged member of a small family of research diluents. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/bacteriostatic-water-30ml-hdpe-plastic

### Bacteriostatic Water - 30ml, Glass

- URL: https://cosmicpeptides.com/products/bacteriostatic-water-30ml
- Type: Laboratory reagent (aqueous solution)
- Compound class: Aqueous research solvent: purified water containing benzyl alcohol as an antimicrobial (bacteriostatic) preservative
- Composition: Water with 0.9% benzyl alcohol (9.0 mg/mL when expressed, as is conventional, weight per volume; 83.2 mmol/L)
- Sequence / structure: Not applicable (a two-component solution). Preservative: benzyl alcohol, C6H5CH2OH (phenylmethanol)
- PubChem CID: Water 962; benzyl alcohol 244
- pH range: 4.5–7.0 (unbuffered; the acidic end reflects dissolved atmospheric carbon dioxide)
- Container: 30 mL sealed borosilicate glass vial
- Physical form as supplied: Clear, colourless aqueous solution

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 30mL | BACW30 | 26105 | — | — | $17.99 | no |

Bacteriostatic water is not a single compound but a defined two-component solution: purified water as the solvent and benzyl alcohol as a dissolved antimicrobial preservative at a nominal 0.9%. By the usual convention for a dissolved solute this percentage is expressed weight per volume, so each millilitre carries 9.0 mg of benzyl alcohol. With a molecular weight of 108.14 g/mol, that is 83.2 mmol/L, or a mole fraction of about 1.5 × 10^−3: for every benzyl alcohol molecule there are roughly 665 water molecules. A full 30 mL container therefore holds about 270 mg (2.50 mmol) of benzyl alcohol. The solvent, water (H2O, 18.015 g/mol, CAS 7732-18-5, PubChem CID 962), makes up more than 99% of the mass. The preservative, benzyl alcohol (IUPAC name phenylmethanol, C7H8O, CAS 100-51-6, PubChem CID 244), is the simplest aromatic primary alcohol: a hydroxymethyl group (−CH2OH) attached to a benzene ring. Because the product is a mixture, it has no CAS number of its own, and the molecular-formula and molecular-weight fields that apply to a peptide describe here its two components separately. The term bacteriostatic is precise. A bacteriostatic agent inhibits the growth and multiplication of bacteria without necessarily killing them in a short time; a bactericidal agent kills. At 0.9%, benzyl alcohol acts mainly in the first sense: it keeps a solution that is opened and sampled repeatedly from supporting microbial growth, rather than rendering contaminated material free of organisms. That distinction is why the product is classified as a preserved diluent rather than a disinfectant. Benzyl alcohol has a long history as a molecule. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/bacteriostatic-water-30ml

### BPC-157

- URL: https://cosmicpeptides.com/products/bpc-157
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 137525-51-0
- Molecular formula: C62H98N16O22
- Molecular weight: 1419.54
- Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
- Compound class: Linear, unmodified pentadecapeptide; a synthetic partial sequence of the gastric-juice protein body protection compound (BPC)
- Sequence / structure: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH (one-letter code: GEPPPGKPADDAGLV ), all chiral residues in the L-configuration, free N-terminal amine and free C-terminal acid
- PubChem CID: 9941957
- Other designations: BPC 157, Bepecin, PL 14736, PL-10, PLD-116 (synonyms listed in PubChem)
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | BP10 | 26107 | 99.7% | 10.61 mg | $38.99 | yes |

BPC-157 is the pentadecapeptide glycyl-glutamyl-prolyl-prolyl-prolyl-glycyl-lysyl-prolyl-alanyl-aspartyl-aspartyl-alanyl-glycyl-leucyl-valine, written H-GEPPPGKPADDAGLV-OH . It is linear, with no disulfide bonds, terminal capping groups, non-proteinogenic residues or post-translational modifications: every one of its fifteen residues is a standard L-amino acid (or the achiral glycine), joined by ordinary amide bonds from a free N-terminal glycine amine to a free C-terminal valine carboxylic acid. The molecular formula is C62H98N16O22. Its average molecular weight is 1419.54 g/mol when calculated with conventional atomic weights (PubChem rounds it to 1419.5 g/mol). The monoisotopic mass, the value that matters for high-resolution mass spectrometry, is 1418.7042 Da. The compound is registered under CAS number 137525-51-0 and appears in PubChem as compound 9941957, where the depositor synonyms include BPC 157, Bepecin, PL 14736, PL-10 and PLD-116. The name "BPC" stands for body protection compound, the term Sikirić and colleagues at the University of Zagreb used in 1993 for a gastric-juice protein fraction of apparent mass Mr 40,000 (about 40 kDa). The fifteen-residue sequence was described as a partial sequence of that protein, and 157 belongs to the laboratory designation of the synthetic fragment. Early papers group the synthetic fragments as "PL-10" substances; work from the 2000s uses the designation PL 14736 for exactly this sequence; and a 2025 literature and patent review by Józwiak and colleagues surveys the patent filings covering it. Because the PL-10 series contained more than one peptide, the sequence printed in each paper should be checked. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/bpc-157

### BPC-157/TB-500

- URL: https://cosmicpeptides.com/products/bpc-157-tb-500
- Type: Synthetic research peptide, lyophilized powder
- Molecular formula: BLEND
- Compound class: Two-component peptide blend: a linear, proline-rich pentadecapeptide (BPC-157) and an N-acetylated linear heptapeptide corresponding to residues 17–23 of thymosin β4 (TB-500)
- Sequence / structure: BPC-157: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH (GEPPPGKPADDAGLV); TB-500: Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH (Ac-LKKTETQ)
- PubChem CID: BPC-157: 9941957; TB-500: 62707662
- Composition: Equal nominal masses of the two peptides co-packaged as one lyophilized solid; an equal-mass blend contains about 1.60 mol of TB-500 per mol of BPC-157
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5/5mg | BB10 | 26110 | 99.8% | 5.13/5.24 mg | $58.99 | yes |
| 10/10mg | BB20 | 26115 | 99.69% | 10.03/10.24 mg | $89.99 | yes |

BPC-157/TB-500 is not a single compound but a defined mixture of two unrelated synthetic peptides, supplied together as one lyophilized solid. Each component keeps its own CAS number and analytical signature, so this page describes the two side by side; the table below gives the identity data for each, with intact thymosin β4 as a reference point for the TB-500 fragment. BPC-157 is the pentadecapeptide H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH . The letters BPC stand for "body protection compound", the name Sikirić and colleagues at the University of Zagreb gave in 1993 to a protein fraction they isolated from gastric juice; the fifteen-residue sequence was described as a partial sequence of that protein, and 157 is part of the laboratory designation of the synthetic fragment. It is a linear peptide with a free N-terminal amine and a free C-terminal carboxylic acid, all chiral residues in the L-configuration, with the formula C62H98N16O22, an average molecular weight of 1419.54 g/mol and a monoisotopic mass of 1418.7042 Da. It is registered as CAS 137525-51-0 and PubChem CID 9941957. TB-500 , as defined for this blend and for the single-component TB-500 product in this catalog, is the N-acetylated heptapeptide Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH . Its sequence is residues 17 to 23 of thymosin β4 (Tβ4), the segment that contains the protein's central actin-binding motif. Its formula is C38H68N10O14, its average molecular weight 889.01 g/mol and its monoisotopic mass 888.4916 Da; it is registered as CAS 885340-08-9 and PubChem CID 62707662, whose systematic name, N-acetyl-L-leucyl-L-lysyl-L-lysyl-L-threonyl-L-α-glutamyl-L-threonyl-L-glutamine, spells out the sequence and stereochemistry. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/bpc-157-tb-500

### CJC-1295 (No DAC)

- URL: https://cosmicpeptides.com/products/cjc-1295-no-dac
- Type: Synthetic research peptide, lyophilized powder
- Molecular formula: C152H252N44O42
- Molecular weight: 3367.9
- Sequence: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
- Compound class: Synthetic 29-residue linear peptide amide; analogue of the N-terminal fragment of growth hormone-releasing hormone (GHRH)
- Also known as: Modified GRF(1-29), [D-Ala^2, Gln^8, Ala^15, Leu^27]-GRF(1-29)-NH2, tetrasubstituted GRF(1-29)
- Sequence / structure: H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH₂ (one-letter: Y(dA)DAIFTQSYRKVLAQLSARKLLQDILSR-NH₂ )
- Stereochemistry: All residues L except D-alanine at position 2
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | CJ5 | — | — | — | $37.99 | no |
| 10mg | CJ10 | 26090 | 99.7% | 11.14 mg | $42.99 | no |

CJC-1295 (No DAC) is a synthetic 29-amino-acid peptide amide derived from the N-terminal region of growth hormone-releasing hormone (GHRH), the hypothalamic peptide also called growth hormone-releasing factor (GRF). Chemically it is [D-Ala^2, Gln^8, Ala^15, Leu^27]-GRF(1-29)-NH2 : the first 29 residues of the native sequence, with four single-residue substitutions and a C-terminal carboxamide. In the research literature and in compound databases the same molecule appears as "modified GRF(1-29)" or "tetrasubstituted GRF(1-29)"; PubChem holds it as CID 56841945 (fully stereodefined, systematic name L-tyrosyl-D-alanyl-L-α-aspartyl-…-L-seryl-L-argininamide) and as CID 91976842 ("CJC1295 Without DAC"). Its molecular formula is C152H252N44O42, giving an average molecular weight of 3,367.9 g/mol and a monoisotopic mass of 3,365.894 Da. The composition is Leu ×5, Ala ×4 (one of them D), Arg ×3, Gln ×3, Ser ×3, Asp ×2, Ile ×2, Lys ×2, Tyr ×2, and one each of Phe, Thr and Val. That gives five basic side chains (three arginines, two lysines), two acidic side chains (both aspartate; there is no glutamate), three aromatic residues (two tyrosines and a phenylalanine), and no cysteine, methionine, histidine, proline or tryptophan. The absence of sulfur is itself a useful analytical marker, because the native fragment contains one methionine. The name deserves explanation because it causes real confusion. "CJC-1295" was introduced for a GRF(1-29) analogue carrying a DAC , the developer's term for an albumin-binding construct: an extra C-terminal lysine whose ε-amino group carries a 3-maleimidopropionyl group, designed to react with the free thiol of albumin to give a covalent conjugate (Jetté and colleagues, 2005). (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/cjc-1295-no-dac

### DSIP

- URL: https://cosmicpeptides.com/products/dsip
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 62568-57-4
- Molecular formula: C35H48N10O15
- Molecular weight: 848.8
- Sequence: H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH
- Compound class: Linear, unmodified nonapeptide; acidic (two side-chain carboxylic acids plus the C-terminal acid, no basic side chains)
- Sequence: H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH (one-letter code: WAGGDASGE); the six chiral residues of the native sequence are L-configured, the three glycines are achiral
- PubChem CID: 68816 (L-configured structure); International Nonproprietary Name emideltide
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | DS5 | 25067 | 99.7% | 5 mg | $22.99 | yes |

Delta Sleep-Inducing Peptide, abbreviated DSIP, is the nonapeptide tryptophyl-alanyl-glycyl-glycyl-aspartyl-alanyl-seryl-glycyl-glutamic acid, written H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH or, in one-letter code, WAGGDASGE. Its molecular formula is C35H48N10O15, its average molecular weight 848.8 g/mol and its monoisotopic mass 848.3301 Da. It is registered under CAS number 62568-57-4, carries the International Nonproprietary Name emideltide, and appears in PubChem as compound 68816, whose IUPAC name specifies six (2S) stereocentres: one each for Trp^1, Ala^2, Asp^5, Ala^6, Ser^7 and Glu^9. A second PubChem record, CID 3623358, describes the same connectivity with the stereocentres left undefined; it is a database convention for an unspecified stereoisomer mixture and not a description of the native peptide. The name is historical and is kept as the conventional identifier; it describes neither a molecular target nor a mechanism. Schoenenberger and Monnier in Basel reported the isolation and characterization of the peptide in 1977. The sequence was established by amino-acid analysis and sequencing of the isolated material, and the nonapeptide was then synthesized so that natural and synthetic material could be compared. That combination, isolation followed by total synthesis of the assigned structure, is the classical proof of a peptide's identity, and every synthetic DSIP sample in use today traces back to it. Classification is unusual for a peptide of this size. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/dsip

### Epitalon

- URL: https://cosmicpeptides.com/products/epitalon
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 307297-39-8
- Molecular formula: C14H22N4O9
- Molecular weight: 390.35
- Sequence: H-Ala-Glu-Asp-Gly-OH
- Compound class: Linear synthetic tetrapeptide; acidic oligopeptide carrying three carboxylic acid groups and one amine
- Sequence / structure: H-Ala-Glu-Asp-Gly-OH (one-letter code: AEDG), L-alanyl-L-α-glutamyl-L-α-aspartyl-glycine, all chiral residues in the L-configuration
- PubChem CID: 219042
- Other identifiers: FDA UNII O65P17785G; ChEBI 230091; synonyms Epithalon, Epithalone, AEDG
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | ET10 | 26074 | 99.8% | 10.21 mg | $39.99 | yes |
| 50mg | ET50 | 26129 | 99.72% | 49.93 mg | $169.99 | yes |

Epitalon is the tetrapeptide alanyl-glutamyl-aspartyl-glycine, written H-Ala-Glu-Asp-Gly-OH or AEDG; the spellings Epithalon and Epithalone denote the same molecule, and much of the biochemical literature calls it simply "the AEDG peptide". Its systematic IUPAC name, (4S)-4-[[(2S)-2-aminopropanoyl]amino]-5-[[(2S)-3-carboxy-1-(carboxymethylamino)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid, is written from the glutamic acid residue outwards and encodes three stereocentres, all S (L); glycine is achiral. The molecular formula is C14H22N4O9, the average molecular weight 390.35 g/mol and the monoisotopic mass 390.1387 Da. By mass the molecule is 43.08% carbon, 5.68% hydrogen, 14.35% nitrogen and 36.89% oxygen, an oxygen-rich composition that reflects its three free carboxylic acids. It is registered under CAS number 307297-39-8, as PubChem compound 219042, as FDA Unique Ingredient Identifier O65P17785G and as ChEBI 230091. Chemically, Epitalon is a short linear oligopeptide and, within that class, one of the strongly acidic minority. Two of its four residues carry side-chain carboxylic acids, and with the C-terminal carboxyl they outnumber the single basic group, the N-terminal amine. The result is a peptide of net charge about −2 at neutral pH and isoelectric point near pH 3, behaving more like a small polycarboxylic acid than like the cationic peptides that dominate much of peptide research. It contains no aromatic, sulfur-containing or basic side chains: no tryptophan or tyrosine absorbance, no oxidizable methionine or cysteine, no lysine or arginine for tryptic cleavage or cation-exchange retention. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/epitalon

### FOXO4-DRI

- URL: https://cosmicpeptides.com/products/foxo4-dri
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 2460055-10-9
- Molecular formula: C228H388N86O64
- Molecular weight: 5358.06
- Sequence: D-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly)
- Compound class: Synthetic linear 46-residue peptide; all-D retro-inverso (DRI) isomer of a chimera combining a forkhead-domain segment of the transcription factor FOXO4 with an arginine-rich carrier sequence from the HIV-1 Tat basic domain
- Sequence: D-(Leu-Thr-Leu-Arg-Lys-Glu-Pro-Ala-Ser-Glu-Ile-Ala-Gln-Ser-Ile-Leu-Glu-Ala-Tyr-Ser-Gln-Asn-Gly-Trp-Ala-Asn-Arg-Arg-Ser-Gly-Gly-Lys-Arg-Pro-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly) , written N-terminus to C-terminus, every chiral residue in the D configuration
- PubChem CID: 167312269 (a second record, CID 168431240, carries the same formula and masses)
- Stereochemistry: 45 stereocentres: 42 α-carbons (46 residues minus 4 achiral glycines) plus the β-carbons of the single D-threonine and the two D-isoleucines
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | FOX10 | — | — | — | $239.99 | no |

FOXO4-DRI is a 46-residue synthetic peptide in which every chiral amino acid is of the D configuration and the residue order is the reverse of the parent L-peptide. The suffix DRI stands for D-retro-inverso : retro because the sequence is read backwards, inverso because the configuration at each α-carbon is inverted. The molecular formula is C228H388N86O64, the average molecular weight 5358.06 g/mol and the monoisotopic mass 5354.9750 Da. The compound is registered under CAS number 2460055-10-9 and catalogued as PubChem compound 167312269, with a duplicate record at CID 168431240. Because mirror-image isomers are constitutionally identical, the formula and both masses are exactly those of the all-L parent sequence; no mass measurement distinguishes the two, which is why chiral analysis is central here. The chain draws on fourteen of the twenty proteinogenic amino acids, arginine alone filling ten of the 46 positions (full composition tabulated under Analytical Characterization). Those ten arginines and four lysines dominate its physical behaviour: the calculated net charge at pH 7.0 is +10.8, effectively +11, and the calculated isoelectric point lies near 12.5. Reading the supplied sequence in reverse recovers the parent L-peptide, GRKKRRQRRRPPPRKGGSRRNAWGNQSYAELISQAIESAPEKRLTL , which resolves into two modules joined by a proline-rich hinge. Its first ten residues, GRKKRRQRRR , are the basic domain of the trans-activator of transcription (Tat) protein of human immunodeficiency virus type 1, residues 48–57 of UniProt P04608, followed by a seven-residue PPPRKGG spacer. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/foxo4-dri

### GHK-Cu

- URL: https://cosmicpeptides.com/products/ghk-cu
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 89030-95-5
- Molecular formula: C14H23CuN6O4
- Molecular weight: 402.92
- Sequence: Glycyl-L-Histidyl-L-Lysine-Copper
- Compound class: Copper(II) coordination complex of a linear tripeptide; a high-affinity Cu(II)-binding motif first isolated from human plasma
- Sequence / structure: H-Gly-His-Lys-OH (one-letter code: GHK), all chiral residues L, bound 1:1 to Cu(II) through the glycine amine, the deprotonated Gly–His amide nitrogen and the histidine imidazole
- PubChem CID: 71587328 (copper complex); 73587 (free GHK)
- Synonyms: GHK copper; Cu(II)-GHK; copper glycyl-histidyl-lysine; [N^2-(N-glycyl-L-histidyl)-L-lysinato]copper
- Physical form as supplied: Lyophilized powder (blue to violet-blue, the colour of the Cu(II) chromophore)

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 50mg | CU50 | 25065 | 99.8% | 50 mg | $32.99 | yes |

GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, written H-Gly-His-Lys-OH or GHK. Unlike most research peptides, it is not a single organic molecule but a metal–ligand assembly: one Cu^2+ ion held by three nitrogen atoms of the peptide, with a fourth, labile position occupied by water or another weak donor. That makes GHK-Cu as much an object of bioinorganic chemistry as of peptide chemistry, and most of what is distinctive about it, from its colour to its behaviour on an HPLC column, follows from the copper centre. PubChem records the complex as compound 71587328, with the formula C14H23CuN6O4, a formal charge of +1, an average molecular weight of 402.92 g/mol and a monoisotopic mass of 402.1077 Da. The CAS registry number of the copper complex is 89030-95-5. The metal-free peptide is a separate entry: PubChem compound 73587, CAS 49557-75-7, C14H24N6O4, 340.38 g/mol, IUPAC name (2S)-6-amino-2-[[(2S)-2-[(2-aminoacetyl)amino]-3-(1H-imidazol-5-yl)propanoyl]amino]hexanoic acid. Comparing the two formulas shows the chemistry of complex formation directly: the complex has one hydrogen fewer than the free peptide plus one copper atom (340.38 − 1.008 + 63.546 = 402.92 g/mol), because binding Cu^2+ displaces the proton of the Gly–His amide nitrogen. The +1 charge describes the species that dominates at neutral pH. Counting charges: Cu^2+ contributes +2, the deprotonated amide −1, the C-terminal carboxylate −1 and the protonated lysine ε-amine +1, for a net +1. Any isolated solid therefore also contains a counterion (commonly acetate or chloride, or trifluoroacetate from purification), which the formula and molecular weight of the cation alone do not include. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/ghk-cu

### GLOW (BPC-157, TB-500, GHK-Cu)

- URL: https://cosmicpeptides.com/products/glow-bpc-157-tb-500-ghk-cu
- Type: Synthetic research peptide, lyophilized powder
- Compound class: Defined mixture of three synthetic peptides: a linear pentadecapeptide (BPC-157), an N-acetylated heptapeptide matching residues 17–23 of thymosin β4 (TB-500), and the 1:1 copper(II) complex of glycyl-L-histidyl-L-lysine (GHK-Cu)
- Nominal composition: GHK-Cu 50 mg, BPC-157 10 mg, TB-500 10 mg in the 70 mg format (mass ratio 5 : 1 : 1)
- Sequence / structure: BPC-157 H-GEPPPGKPADDAGLV-OH ; TB-500 Ac-LKKTETQ-OH ; GHK-Cu H-Gly-His-Lys-OH coordinated to Cu(II)
- PubChem CIDs: BPC-157 9941957; TB-500 62707662; GHK-Cu 71587328; GHK 73587
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 70mg | GL70 | 25051 | 99.8% | 50/10/10 mg | $79.99 | yes |

GLOW is not a single molecule but a fixed-ratio mixture of three chemically unrelated peptides, each also studied on its own: BPC-157 , TB-500 and GHK-Cu . Nothing in the blend is covalently linked, so the mixture has no formula, molecular weight or CAS number of its own; its defining property is its nominal composition, 50 mg GHK-Cu, 10 mg BPC-157 and 10 mg TB-500. BPC-157 is the fifteen-residue peptide H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH (CAS 137525-51-0, PubChem CID 9941957), C62H98N16O22, average molecular weight 1419.5 g/mol, monoisotopic mass 1418.7042 Da. The name abbreviates "body protection compound": the sequence was described as a partial sequence of a larger protein isolated from gastric juice. TB-500 , as defined for this product and for the shop's stand-alone TB-500, is the N-acetylated heptapeptide Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH (CAS 885340-08-9, PubChem CID 62707662), C38H68N10O14, 889.0 g/mol, monoisotopic mass 888.4916 Da. It reproduces residues 17–23 of thymosin β4 (Tβ4), the 43-residue acetylated actin-monomer-binding polypeptide (C212H350N56O78S, about 4963 g/mol, PubChem CID 16132341). "TB-500" has been used loosely for both; mass spectrometry tells them apart at once. GHK-Cu is the copper(II) complex of glycyl-L-histidyl-L-lysine (GHK; C14H24N6O4, 340.38 g/mol, CID 73587). PubChem records the 1:1 complex (CAS 89030-95-5, CID 71587328) as the cation C14H23CuN6O4^+, 402.92 g/mol, monoisotopic mass 402.1077 Da. As a cation it always carries a counterion in the solid, commonly acetate or chloride, so its weighed formula weight is higher. GHK-Cu is five-sevenths of the blend by mass and the dominant component by moles.

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/glow-bpc-157-tb-500-ghk-cu

### Ipamorelin

- URL: https://cosmicpeptides.com/products/ipamorelin
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 170851-70-4
- Molecular formula: C38H49N9O5
- Molecular weight: 711.9
- Sequence: H-Aib-His-D-2Nal-D-Phe-Lys-NH2
- Compound class: Synthetic linear pentapeptide amide containing non-proteinogenic and D-amino acids; growth hormone-releasing peptide (GHRP) family; agonist ligand of the growth hormone secretagogue receptor type 1a (GHS-R1a, the ghrelin receptor)
- Sequence: H-Aib-His-D-2Nal-D-Phe-Lys-NH2 (Aib = 2-aminoisobutyric acid; D-2Nal = 3-(2-naphthyl)-D-alanine; C-terminal primary amide)
- PubChem CID: 9831659
- Other identifiers: Development code NNC 26-0161; InChIKey NEHWBYHLYZGBNO-BVEPWEIPSA-N
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | IP10 | 26108 | 99.8% | 10.13 mg | $54.99 | yes |

Ipamorelin is a synthetic pentapeptide, H-Aib-His-D-2Nal-D-Phe-Lys-NH2 . Its systematic name, (2S)-6-amino-2-[[(2R)-2-[[(2R)-2-[[(2S)-2-[(2-amino-2-methylpropanoyl)amino]-3-(1H-imidazol-5-yl)propanoyl]amino]-3-naphthalen-2-ylpropanoyl]amino]-3-phenylpropanoyl]amino]hexanamide, reads from the C-terminus inwards and records its four stereocentres: L-lysine (2S), D-phenylalanine (2R), D-3-(2-naphthyl)alanine (2R) and L-histidine (2S). The fifth residue, 2-aminoisobutyric acid (Aib, or 2-methylalanine), is achiral, carrying two methyl groups on its α-carbon. In CAS style the peptide is 2-methylalanyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-D-phenylalanyl-L-lysinamide. The free base has the molecular formula C38H49N9O5, an average molecular weight of 711.87 g/mol (listed as 711.9 in PubChem) and a monoisotopic mass of 711.3857 Da. It carries CAS number 170851-70-4 and PubChem CID 9831659, and was disclosed in 1998 by Raun and colleagues at Novo Nordisk in Måløv, Denmark, under the code NNC 26-0161; the name follows the "-relin" stem for peptides acting on the pituitary hormone-release axis. Ipamorelin belongs to the growth hormone-releasing peptides (GHRPs), small synthetic peptides acting at the growth hormone secretagogue receptor type 1a (GHS-R1a). That receptor was cloned only in 1996, years after the first GHRPs had been made, and its endogenous ligand, the acylated stomach peptide ghrelin, in 1999: this is a ligand class designed by structure–activity chemistry before its target was known. It is distinct from the peptides that act on the growth hormone-releasing hormone receptor (GHRHR), such as Sermorelin , which are longer, all-L sequences derived from the 44-residue hypothalamic hormone and signal through a different G protein-coupled receptor.

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/ipamorelin

### Kisspeptin-10

- URL: https://cosmicpeptides.com/products/kisspeptin-10
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 374675-21-5
- Molecular formula: C63H83N17O14
- Molecular weight: 1302.4
- Sequence: H-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
- Compound class: Linear C-terminally amidated decapeptide; RF-amide peptide family; C-terminal fragment of the KISS1 gene product
- Sequence: H-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 (one-letter code: YNWNSFGLRF-NH2), all chiral residues in the L-configuration
- PubChem CID: 25240297
- Common synonyms: KP-10, Kisspeptin-10 (human sequence), metastin (45–54), kisspeptin-13 (4–13)
- Molecular target studied in vitro: Kisspeptin receptor KISS1R (formerly GPR54, AXOR12, hOT7T175); UniProt Q969F8, 398 residues
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | KS5 | 26112 | 99.7% | 5.76 mg | $34.99 | yes |
| 10mg | KS10 | 25036 | 99.7% | 10.82 mg | $47.99 | no |

Kisspeptin-10 is the decapeptide H-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 , the shortest fully active C-terminal fragment of the precursor protein encoded by the KISS1 gene. In the mature precursor (UniProt Q15726, 138 residues, of which residues 1–19 form a signal sequence), the decapeptide occupies positions 112–121 and terminates in a phenylalanine amide, a post-translational modification recorded in the same database entry. Because the 54-residue fragment of this precursor was originally named metastin and numbered 1–54 beginning at residue 68, the same decapeptide appears in the older literature as metastin (45–54); PubChem retains both names as synonyms of CID 25240297. The molecular formula is C63H83N17O14, with an average molecular weight of 1302.4 g/mol and a monoisotopic mass of 1301.6305 Da for the neutral free base. Summing the ten residue masses with a water-equivalent terminus and the C-terminal amide reproduces both values exactly; relative to the corresponding free acid, the amide terminus trades an oxygen for a nitrogen and a hydrogen, lowering the mass by 0.984 Da. The compound is registered under CAS number 374675-21-5 and carries the UNII code FS1N52VS3S. Chemically, Kisspeptin-10 belongs to the RF-amide family, a group of peptides defined by the Arg-Phe-NH2 C-terminus. That terminal dipeptide amide is the family's signature recognition element. The receptor itself, first cloned as the orphan GPR54, was renamed the kisspeptin receptor (KISS1R) by the IUPHAR nomenclature committee once the ligand pairing had been established, following the convention of naming a receptor after its endogenous ligand. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/kisspeptin-10

### KPV

- URL: https://cosmicpeptides.com/products/kpv
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 67727-97-3
- Molecular formula: C16H30N4O4
- Molecular weight: 342.43
- Sequence: H-Lys-Pro-Val-OH
- Compound class: Linear tripeptide; C-terminal fragment (residues 11–13) of α-melanocyte-stimulating hormone (α-MSH)
- Sequence: H-Lys-Pro-Val-OH (one-letter code: KPV), all residues in the L-configuration
- PubChem CID: 125672
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | KP5 | — | — | — | $32.99 | no |
| 10mg | KP10 | 26121 | 99.8% | 10.24 mg | $27.99 | yes |

KPV is the tripeptide lysyl-prolyl-valine, written H-Lys-Pro-Val-OH . It corresponds to residues 11, 12 and 13 of α-melanocyte-stimulating hormone (α-MSH), the thirteen-residue product of pro-opiomelanocortin (POMC) processing whose full sequence is Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2. In the parent hormone the C-terminal valine is amidated; the research compound supplied as KPV carries a free C-terminal carboxylic acid, a distinction that matters when comparing literature reports, because amidated and free-acid tripeptides differ in net charge, retention behaviour and recognition by peptide transporters. The IUPAC name, (2S)-2-[[(2S)-1-[(2S)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-methylbutanoic acid, encodes the three stereocentres, all of the S (L) configuration. The molecular formula is C16H30N4O4, the average molecular weight 342.43 g/mol, and the monoisotopic mass 342.2267 Da. KPV is registered under CAS number 67727-97-3 and as PubChem compound 125672. Chemically, KPV belongs to the class of short linear oligopeptides. It is small enough to behave in many respects like a polar small molecule (it is freely water-soluble and carries no secondary structure of its own), yet it retains the defining features of a peptide: two amide bonds, a free N-terminal amine, a free C-terminal acid and side chains that dictate its charge and hydrophobicity. That combination makes KPV a convenient model compound for studying how a minimal fragment of a larger signalling peptide behaves in isolation. The interest in KPV traces back to structure–activity work on α-MSH in the late 1980s, when researchers dissected the hormone into fragments to find out which portion carried which activity. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/kpv

### LL-37

- URL: https://cosmicpeptides.com/products/ll-37
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 597562-32-8
- Molecular formula: C205H340N60O53
- Molecular weight: 4493.0
- Sequence: H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
- Compound class: Cationic, amphipathic α-helical antimicrobial peptide; 37-residue C-terminal domain of the human cathelicidin precursor hCAP-18 (gene CAMP )
- Sequence: H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (one-letter code [LL-37, 37 aa] ), all residues in the L-configuration, free N-terminal amine and free C-terminal acid
- PubChem CID: 16198951
- Net charge at pH 7: approximately +6 (twelve basic sites, six acidic sites)
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | LL5 | 25028 | 99.5% | 5.21 mg | $49.99 | yes |

LL-37 is a 37-residue linear peptide whose name comes from its own chemistry: the chain begins with two leucine residues (LL) and is 37 amino acids long. It is the mature antimicrobial domain released from the C-terminus of hCAP-18, the cationic antimicrobial protein of 18 kDa and the only cathelicidin known in this species. Its gene, CAMP , lies on chromosome 3 at 3p21.3 and encodes a preproprotein consisting of a signal sequence, a conserved cathelin-like domain of roughly 100 residues, and the variable C-terminal antimicrobial segment that becomes LL-37 after proteolytic release. Sørensen and colleagues showed in 2001 that extracellular cleavage by proteinase 3 converts stored hCAP-18 into LL-37, so the peptide is generated by proteolysis of a stored precursor rather than expressed directly as the mature chain. Chemically, LL-37 belongs to the cationic amphipathic α-helical class of antimicrobial peptides, the structural family that also contains magainins, cecropins and melittin. The defining features of that class are all present: a high content of basic residues (six lysines and five arginines), a modest number of acidic residues (two aspartates and three glutamates), no cysteine and therefore no disulfide constraint, and a residue order in which hydrophobic and cationic side chains segregate onto opposite faces once the backbone is helical. The complete amino-acid composition is Lys6, Arg5, Phe4, Leu4, Glu3, Ile3, Asp2, Gly2, Ser2, Val2, Asn1, Gln1, Pro1 and Thr1. Three absences shape both the chemistry and the analytics of this sequence. No cysteine, so the peptide forms no disulfides and needs no oxidative folding step after synthesis. No methionine, removing the most common site of oxidative modification in stored peptide solutions. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/ll-37

### MOTS-c

- URL: https://cosmicpeptides.com/products/mots-c
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 1627580-64-6
- Molecular formula: C101H152N28O22S2
- Molecular weight: 2174.62
- Sequence: H-Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg-OH
- Compound class: Linear 16-residue mitochondrial-derived peptide (MDP), encoded by a short open reading frame inside the mitochondrial 12S rRNA gene MT-RNR1
- Sequence: H-Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg-OH (one-letter code MRWQEMGYIFYPRKLR ); all-L, free N-terminal amine and free C-terminal acid
- PubChem CID: 146675088
- Genomic coordinates: Nucleotides 1343–1390 of the revised Cambridge Reference Sequence (rCRS, NC_012920.1), in-frame TAG terminator at 1391–1393
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | MS5 | — | — | — | $29.99 | no |
| 10mg | MS10 | 26118 | 99.87% | 10.22 mg | $47.99 | yes |
| 40mg | MS40 | — | — | — | $129.99 | no |

MOTS-c — mitochondrial open reading frame of the twelve S rRNA type-c — is a hexadecapeptide, sequence MRWQEMGYIFYPRKLR . It belongs to the mitochondrial-derived peptides (MDPs): short polypeptides encoded inside mitochondrial genes long annotated only as ribosomal RNA. The first described was humanin, from a frame inside the 16S rRNA gene MT-RNR2 ; MOTS-c, reported by Lee and colleagues in 2015, comes from the 12S rRNA gene MT-RNR1 . Further frames in the region have since been catalogued as the SHLP series. The free peptide has the molecular formula C101H152N28O22S2, an average molecular weight of 2174.62 g/mol and a monoisotopic mass of 2173.108 Da. It is indexed under CAS number 1627580-64-6 and PubChem CID 146675088, with the systematic name L-methionyl-L-arginyl-L-tryptophyl-L-glutaminyl-L-α-glutamyl-L-methionylglycyl-L-tyrosyl-L-isoleucyl-L-phenylalanyl-L-tyrosyl-L-prolyl-L-arginyl-L-lysyl-L-leucyl-L-arginine. MOTS-c is a medium-length linear peptide with no disulfide bond, no post-translational modification in its canonical form and no terminal capping: the N-terminal methionine retains a free α-amino group and the C-terminal arginine a free carboxylate. That matters when literature reports are compared, since amidated or acetylated analogues differ in net charge, chromatographic retention and observed mass by predictable increments (−0.984 Da for C-terminal amidation, +42.011 Da for N-terminal acetylation). Encoding in the Mitochondrial Genome The frame can be located exactly. In the rCRS (NC_012920.1), nucleotides 1343–1390 read ATG AGG TGG CAA GAA ATG GGC TAC ATT TTC TAC CCC AGA AAA CTA CGA — sixteen codons followed by a TAG terminator at 1391–1393. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/mots-c

### NAD+

- URL: https://cosmicpeptides.com/products/nad
- Type: Research compound (small molecule), solid
- CAS number: 53-84-9
- Molecular formula: C21H27N7O14P2
- Molecular weight: 664.0
- Compound class: Dinucleotide coenzyme (pyridine nucleotide); not a peptide. Two ribonucleotides, nicotinamide mononucleotide and adenosine 5′-monophosphate, joined 5′ to 5′ through a pyrophosphate bridge
- Structure: β-Nicotinamide adenine dinucleotide, oxidized form (β-NAD^+), as the inner salt: a 3-carbamoylpyridinium (nicotinamide) cation balanced by one ionized phosphate. Synonyms: nadide, coenzyme I, diphosphopyridine nucleotide (DPN), cozymase
- PubChem CID: 5892
- Physical form as supplied: White to off-white solid powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 500mg | NJ500 | 26096 | 99.8% | 503 mg | $48.99 | yes |
| 1000mg | NJ1000 | 26123 | 99.76% | 998.34 mg | $79.99 | yes |

NAD^+ is nicotinamide adenine dinucleotide in its oxidized form. Although it appears in a catalogue of research peptides, it is not a peptide: it contains no amino acids and no amide backbone. It is a dinucleotide , built from two nucleotides that share a pyrophosphate (diphosphate) linkage. One nucleotide is nicotinamide mononucleotide (NMN), in which the pyridine base nicotinamide is attached to C1′ of a D-ribose through a β-N-glycosidic bond; the other is adenosine 5′-monophosphate (AMP). The 5′-phosphate of each ribose is joined to the other through a phosphoanhydride bond, giving the sequence nicotinamide–ribose–phosphate–phosphate–ribose–adenine. The PubChem IUPAC name, [[(2 R ,3 S ,4 R ,5 R )-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2 R ,3 S ,4 R ,5 R )-5-(3-carbamoylpyridin-1-ium-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphate, spells out the eight stereocentres of the two D-ribofuranose rings and the positive charge on the pyridinium nitrogen. The neutral, isolable compound registered under CAS 53-84-9 is the inner salt (sometimes called the free acid): the cationic pyridinium ring is balanced by one ionized phosphate, while the second phosphate carries a proton. Its formula is C21H27N7O14P2, its average molecular weight 663.43 g/mol and its monoisotopic mass 663.1091 Da (PubChem CID 5892). The "+" in NAD^+ refers to the formal charge on the nicotinamide ring, not to the charge of the whole molecule. At pH 7 both phosphates are ionized, so the species in solution carries a net charge of −1 (one positive pyridinium, two negative phosphates). The reduced form, NADH (C21H29N7O14P2 as the free acid, PubChem CID 439153), carries an uncharged 1,4-dihydronicotinamide ring and therefore a net charge of −2 at pH 7. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/nad

### Oxytocin

- URL: https://cosmicpeptides.com/products/oxytocin
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 50-56-6
- Molecular formula: C43H66N12O12S2
- Molecular weight: 1007.2
- Sequence: H-Cys(1)-Tyr-Ile-Gln-Asn-Cys(1)-Pro-Leu-Gly-NH2
- Compound class: Cyclic nonapeptide amide of the neurohypophysial peptide family; six-residue disulfide ring (Cys^1–Cys^6) with a three-residue C-terminal tail
- Sequence / structure: H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 (disulfide bond Cys^1–Cys^6; one-letter code CYIQNCPLG-NH2), all residues in the L-configuration
- PubChem CID: 439302
- Molecular target: Oxytocin receptor (OXTR), a class A G protein-coupled receptor of 389 amino acids
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 2mg | OT2 | 26068 | 99.6% | 2.13 mg | $27.99 | yes |
| 10mg | OT10 | 26071 | 99.8% | 10 mg | $59.99 | yes |

Oxytocin is a nonapeptide with a C-terminal carboxamide, written H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 , in which the thiol groups of the two cysteine residues, at positions 1 and 6, are joined in a single intramolecular disulfide bond. The disulfide closes a six-residue ring (Cys^1 to Cys^6); Pro^7-Leu^8-Gly^9-NH2 forms a short tail ending in a primary amide rather than a free acid. Older literature counts the cystine as one amino acid and so calls oxytocin an "octapeptide amide", the wording of the 1953 synthesis paper; modern usage counts the two half-cystines separately, giving nine residues. The molecular formula is C43H66N12O12S2, the average molecular weight 1007.2 g/mol and the monoisotopic mass 1006.4365 Da (PubChem CID 439302). Oxytocin is registered under CAS number 50-56-6. Its systematic IUPAC name, (2S)-1-[(4R,7S,10S,13S,16S,19R)-19-amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-13-[(2S)-butan-2-yl]-16-[(4-hydroxyphenyl)methyl]-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carbonyl]-N-[(2S)-1-[(2-amino-2-oxoethyl)amino]-4-methyl-1-oxopentan-2-yl]pyrrolidine-2-carboxamide, is informative: the disulfide ring appears in it as a twenty-membered macrocycle ("cycloicosane") with two sulfur and five nitrogen atoms, and all nine stereocentres are specified. Those nine stereocentres are the eight α-carbons of the chiral residues (glycine has none) plus the β-carbon of isoleucine. Both cysteine α-carbons carry the descriptor R and the rest S, yet all residues are L: the R label follows from the Cahn–Ingold–Prelog rules, in which the sulfur-bearing side chain outranks the carboxyl carbon. Isoleucine is the (2S,3S) diastereomer; its (2S,3R) epimer, L- allo -isoleucine, is a possible synthesis-related impurity. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/oxytocin

### Pinealon

- URL: https://cosmicpeptides.com/products/pinealon
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 175175-23-2
- Molecular formula: C15H26N6O8
- Molecular weight: 418.4
- Sequence: Glu-Asp-Arg
- Compound class: Linear, unprotected tripeptide; member of the ultrashort (two- to four-residue) peptide bioregulator series, where it is named pinealon and abbreviated EDR
- Sequence: H-Glu-Asp-Arg-OH (one-letter code: EDR), all three residues in the L-configuration
- Monoisotopic mass: 418.1812 Da
- PubChem CID: 10273502 (ChEBI:156374)
- Ionization: Three carboxylic acids against one guanidinium group and one α-amino group; net charge approximately −1 at pH 7.0; calculated isoelectric point near 4.1
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | PNL10 | 25042 | 99.73% | 11.30 mg | $34.99 | yes |

Pinealon is the tripeptide L-glutamyl-L-aspartyl-L-arginine, written H-Glu-Asp-Arg-OH and almost always abbreviated EDR in the primary literature. It is fully unprotected — free α-amino group, free C-terminal acid, no acetylation, amidation, cyclisation or non-natural residue. Its formula is C15H26N6O8, average molecular weight 418.40 g/mol, monoisotopic mass 418.1812 Da; it carries CAS number 175175-23-2 and appears as PubChem compound 10273502 and ChEBI:156374. Its systematic name, (4S)-4-amino-5-[[(2S)-3-carboxy-1-[[(1S)-1-carboxy-4-(diaminomethylideneamino)butyl]amino]-1-oxopropan-2-yl]amino]-5-oxopentanoic acid, encodes the L-configuration at all three α-carbons, free γ- and β-carboxyls on glutamate and aspartate, and arginine's guanidine side chain as the only basic group. Formula, mass and sequence can be checked against each other. Summing the monoisotopic residue masses of glutamate (129.04259 Da), aspartate (115.02694 Da) and arginine (156.10111 Da) gives 400.17064 Da; adding one water molecule (18.01056 Da) for the two amide condensations gives 418.18120 Da, matching the computed monoisotopic mass of C15H26N6O8 (418.18121 Da) to within 0.00001 Da. The elemental tally agrees too: glutamate contributes C5, aspartate C4 and arginine C6 for the fifteen carbons, and arginine's four nitrogens plus two backbone nitrogens account for all six. Among ultrashort peptides — oligopeptides of two to four residues — EDR is unusual for being strongly anionic: two of its three side chains are carboxylic acids and the free C-terminus adds a third. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/pinealon

### PT-141

- URL: https://cosmicpeptides.com/products/pt-141
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 189691-06-3
- Molecular formula: C50H68N14O10
- Molecular weight: 1025.18
- Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH
- Compound class: Synthetic cyclic lactam heptapeptide; side-chain-to-side-chain macrocyclic analogue of α-melanocyte-stimulating hormone (α-MSH) residues 4–10
- Sequence / structure: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH ; acetylated N-terminus, 23-membered lactam bridge between the aspartate β-carboxyl and the lysine ε-amine, free C-terminal carboxylic acid on lysine
- PubChem CID: 9941379
- Stereochemistry: Seven defined stereocentres; six L-configured residues plus D-phenylalanine at the position corresponding to Phe^7 of α-MSH
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | PT10 | 25056 | 99.8% | 10.14 mg | $38.99 | yes |

PT-141, assigned the International Nonproprietary Name bremelanotide, is a synthetic macrocyclic heptapeptide written Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH . It belongs to the melanotropin family: ligands built around the recognition sequence of α-melanocyte-stimulating hormone (α-MSH), the tridecapeptide Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2 produced by processing of pro-opiomelanocortin (POMC). PT-141 is not a literal fragment of that hormone but a conformationally constrained redesign of residues 4 through 10, in which two side chains are joined into a covalent ring and two residues are replaced to remove chemical liabilities. The molecular formula is C50H68N14O10, giving an average molecular weight of 1025.18 g/mol and a monoisotopic mass of 1024.5243 Da. The compound is registered under CAS number 189691-06-3 and catalogued as PubChem compound 9941379, InChIKey FFHBJDQSGDNCIV-MFVUMRCOSA-N. Systematic nomenclature renders the macrocycle as a cyclotricosane ring system: (3S,6S,9R,12S,15S,23S)-15-[[(2S)-2-acetamidohexanoyl]amino]-9-benzyl-6-[3-(diaminomethylideneamino)propyl]-12-(1H-imidazol-5-ylmethyl)-3-(1H-indol-3-ylmethyl)-2,5,8,11,14,17-hexaoxo-1,4,7,10,13,18-hexazacyclotricosane-23-carboxylic acid. The 9R descriptor is the D-phenylalanine stereocentre; every other stereocentre is S (L). Two substitutions distinguish the scaffold from the parent sequence. Methionine 4 of α-MSH is replaced by norleucine, (2S)-2-aminohexanoic acid (C6H13NO2, 131.17 g/mol), an isosteric non-proteinogenic residue that keeps the straight-chain hydrophobic side chain while deleting the thioether sulfur; PT-141 therefore contains no sulfur at all, unlike α-MSH (C77H109N21O19S, 1664.9 g/mol), and cannot form a methionine sulfoxide. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/pt-141

### Selank

- URL: https://cosmicpeptides.com/products/selank
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 29954-34-3
- Molecular formula: C33H57N11O9
- Molecular weight: 751.9
- Sequence: H-Thr-Lys-Pro-Arg-Pro-Gly-Pro-OH
- Compound class: Synthetic linear heptapeptide; the tetrapeptide tuftsin (Thr-Lys-Pro-Arg) extended at its C-terminus by the glyproline tripeptide Pro-Gly-Pro
- Sequence: H-Thr-Lys-Pro-Arg-Pro-Gly-Pro-OH (one-letter code: TKPRPGP), all chiral residues in the L-configuration
- PubChem CID: 11765600
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | SK5 | 25013 | 99.8% | 5.28 mg | $24.99 | no |
| 10mg | SK10 | 26099 | 99.7% | 10.26 mg | $32.99 | yes |

Selank is the synthetic heptapeptide L-threonyl-L-lysyl-L-prolyl-L-arginyl-L-prolyl-glycyl-L-proline, written H-Thr-Lys-Pro-Arg-Pro-Gly-Pro-OH or, in one-letter code, TKPRPGP. It carries a free N-terminal amine and a free C-terminal carboxylic acid; neither terminus is acetylated or amidated. The molecular formula of the free base is C33H57N11O9, the average molecular weight 751.9 g/mol and the monoisotopic mass 751.4341 Da. The compound is registered under CAS number 129954-34-3 and appears in PubChem as compound 11765600, where it is also listed under the laboratory code TP-7 and the transliteration Selanc. The full IUPAC name, (2S)-1-[2-[[(2S)-1-[(2S)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S,3R)-2-amino-3-hydroxybutanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]acetyl]pyrrolidine-2-carboxylic acid, reads from the C-terminal proline outwards and encodes seven defined stereocentres: two in threonine (2S,3R), one each in lysine, arginine and the three prolines (all 2S). Glycine, the only achiral residue, sits between the last two prolines. Structurally, Selank is two modules joined head to tail. The N-terminal four residues are identical to tuftsin , Thr-Lys-Pro-Arg, first described by Najjar and Nishioka in 1970 and named after Tufts University; the sequence corresponds to residues 289–292 of the IgG heavy chain, in the CH2 domain of the Fc region, and is released from the immunoglobulin by sequential proteolytic cuts. The C-terminal three residues, Pro-Gly-Pro, belong to the glyprolines , the short proline- and glycine-rich peptides that Ashmarin and colleagues described as modules for stabilising and extending regulatory peptides. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/selank

### Semax

- URL: https://cosmicpeptides.com/products/semax
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 80714-61-0
- Molecular formula: C37H51N9O10S
- Molecular weight: 813.9
- Sequence: H-Met-Glu-His-Phe-Pro-Gly-Pro-OH
- Compound class: Synthetic linear heptapeptide; the ACTH(4–7) tetrapeptide Met-Glu-His-Phe joined to the C-terminal glyproline tripeptide Pro-Gly-Pro, often written ACTH(4–7)PGP
- Sequence: H-Met-Glu-His-Phe-Pro-Gly-Pro-OH (one-letter code: MEHFPGP), all chiral residues in the L-configuration
- PubChem CID: 9811102
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | XA10 | 26098 | 99.6% | 11.06 mg | $28.99 | yes |

Semax is the heptapeptide L-methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-prolylglycyl-L-proline, written H-Met-Glu-His-Phe-Pro-Gly-Pro-OH or MEHFPGP. It is a designed molecule rather than a natural one: its first four residues reproduce positions 4 to 7 of adrenocorticotropic hormone (ACTH), and its last three residues are the tripeptide Pro-Gly-Pro, a member of the glyproline family of short proline- and glycine-rich peptides. For this reason the literature frequently calls it ACTH(4–7)PGP, and describes it as an analogue of ACTH(4–10), the heptapeptide Met-Glu-His-Phe-Arg-Trp-Gly from which it was derived. The IUPAC name recorded by PubChem, (2S)-1-[2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-4-methylsulfanylbutanoyl]amino]-4-carboxybutanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]amino]-3-phenylpropanoyl]pyrrolidine-2-carbonyl]amino]acetyl]pyrrolidine-2-carboxylic acid, encodes six defined stereocentres, all of the S configuration (glycine, the seventh residue, is achiral). The molecular formula is C37H51N9O10S, the average molecular weight 813.9 g/mol and the monoisotopic mass 813.3480 Da. Semax is registered under CAS number 80714-61-0 and appears in PubChem as compound 9811102. Two design ideas meet in this sequence. The ACTH(4–7) segment, Met-Glu-His-Phe, is the N-terminal half of the sequence that the melanocortin peptides share: ACTH, α-melanocyte-stimulating hormone (α-MSH, which is ACTH(1–13) with an acetylated N-terminus and an amidated C-terminus) and the related fragments all contain it, because they are all cut from the same precursor, pro-opiomelanocortin (POMC). The Pro-Gly-Pro extension replaces the Arg-Trp-Gly that follows in ACTH(4–10). (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/semax

### Sermorelin

- URL: https://cosmicpeptides.com/products/sermorelin
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 86168-78-7
- Molecular formula: C149H246N44O42S
- Molecular weight: 3357.9
- Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
- Compound class: Linear 29-residue peptide amide; the N-terminal fragment (residues 1–29) of human growth hormone-releasing hormone (GHRH), written GRF(1–29)NH2 or hGHRH(1–29)NH2
- Sequence / structure: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 ( YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 ), all L-configuration, C-terminus amidated
- PubChem CID: 16132413 (also UNII 89243S03TE, ChEBI 9118)
- Charge and isoelectric point: Net charge approximately +4 at pH 7.0; calculated isoelectric point 10.95 (calculated, EMBOSS pKa set)
- Chromophores: Two Tyr, one Phe; calculated molar extinction coefficient 2980 M^−1cm^−1 at 280 nm
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | SMO10 | 26085 | 99.7% | 11.05 mg | $54.99 | yes |

Sermorelin is the synthetic peptide amide corresponding to residues 1 through 29 of human growth hormone-releasing hormone, a 44-residue hypothalamic peptide of the secretin structural superfamily. It appears in the literature as GRF(1–29)NH2, hGRF(1–29)NH2 and hGHRH(1–29)NH2, and under its Chemical Abstracts index name as somatoliberin 29-L-argininamide with residues 30–44 deleted — all the same covalent entity, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 , registered as CAS 86168-78-7 and PubChem CID 16132413. It is not somatorelin, the name of the full-length 44-residue amide (C215H358N72O66S, about 5040 g/mol, PubChem CID 16132353): two letters apart in name, fifteen residues and some 1680 g/mol apart in substance. The parent hormone is encoded as a 108-residue precursor, somatoliberin (UniProt P01286), in which the mature hormone begins at Tyr32 immediately after an Arg30-Arg31 dibasic processing site and ends at Leu75, whose amide is generated enzymatically from a glycine extension by peptidylglycine α-amidating monooxygenase. Sermorelin reproduces only the first 29 of those 44 residues and its amide is installed synthetically on Arg29. The amide matters when comparing data across sources: GRF(1–29)NH2 and GRF(1–29)OH are different compounds whose monoisotopic masses differ by only 0.984 Da, which a nominal-mass instrument cannot resolve. The choice of residue 29 as the truncation point came out of systematic structure–activity chemistry. Ling and colleagues synthesized a graded series of C-terminally shortened hGRF analogues with free-acid or amidated termini and measured growth hormone release from anterior pituitary cells in monolayer culture. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/sermorelin

### SS-31

- URL: https://cosmicpeptides.com/products/ss-31
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 736992-21-5
- Molecular formula: C32H49N9O5
- Molecular weight: 639.8
- Sequence: H-D-Arg-Tyr(2,6-diMe)-Lys-Phe-NH2
- Compound class: Synthetic linear tetrapeptide amide of the Szeto-Schiller (SS) aromatic-cationic series; contains one D-amino acid and one non-proteinogenic amino acid
- Sequence / structure: H-D-Arg-Dmt-Lys-Phe-NH2 , where Dmt is 2′,6′-dimethyl-L-tyrosine; IUPAC-style name D-arginyl-2,6-dimethyl-L-tyrosyl-L-lysyl-L-phenylalaninamide
- PubChem CID: 11764719
- Formal charge at pH 7: +3 (N-terminal amine, arginine guanidinium, lysine ε-ammonium; the C-terminus is an uncharged amide)
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | SS10 | 26080 | 99.78% | 10.12 mg | $49.99 | yes |
| 25mg | 2S25 | 26125 | 99.78% | 25.16 mg | $99.99 | yes |

SS-31 is the tetrapeptide amide H-D-Arg-Dmt-Lys-Phe-NH2 . Reading from the N-terminus it contains D-arginine, the synthetic aromatic amino acid 2′,6′-dimethyl-L-tyrosine (Dmt), L-lysine and L-phenylalanine, with the C-terminal carboxyl converted to a primary carboxamide. Its systematic name is D-arginyl-2,6-dimethyl-L-tyrosyl-L-lysyl-L-phenylalaninamide; PubChem gives the full IUPAC name as (2S)-6-amino-2-[[(2S)-2-[[(2R)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]-3-(4-hydroxy-2,6-dimethylphenyl)propanoyl]amino]-N-[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]hexanamide. The four defined stereocentres are one R (the D-arginine α-carbon) and three S (Dmt, lysine and phenylalanine). The molecular formula is C32H49N9O5, the average molecular weight 639.8 g/mol (639.80 from standard atomic weights) and the monoisotopic mass 639.3857 Da, under CAS number 736992-21-5 and PubChem CID 11764719. The letters "SS" stand for Szeto and Schiller, whose laboratories designed the series; the same entity appears in the literature and in chemical databases under the synonym elamipretide and as the shorthand D-Arg-Dmt-Lys-Phe-NH2. What sets SS-31 apart from ordinary tetrapeptides is the deliberate alternation of basic and aromatic residues, a design its originators called the aromatic-cationic motif: three positive charges in water, yet two bulky aromatic side chains able to insert into the non-polar region of a lipid bilayer. That makes it a widely used tool compound in membrane biophysics and in in vitro studies of the mitochondrial inner membrane, where cardiolipin is concentrated. Both termini are also blocked against exopeptidase chemistry: an N-terminal D-residue is a poor aminopeptidase substrate, and the C-terminal amide removes the carboxylate carboxypeptidases recognize.

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/ss-31

### TB-500

- URL: https://cosmicpeptides.com/products/tb500
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 885340-08-9
- Molecular formula: C38H68N10O14
- Molecular weight: 889.2
- Sequence: Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH
- Compound class: Linear, N-terminally acetylated heptapeptide; residues 17–23 of thymosin β4 (Tβ4), the segment that contains the conserved LKKTET actin-binding motif of the β-thymosin/WH2 family
- Sequence / structure: Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH (one-letter code: Ac-LKKTETQ), all residues in the L-configuration, free C-terminal acid
- PubChem CID: 62707662
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | TB10 | 25058 | 99.8% | 9.97 mg | $54.99 | yes |

The compound sold here as TB-500 is the heptapeptide Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH : N-acetyl-L-leucyl-L-lysyl-L-lysyl-L-threonyl-L-α-glutamyl-L-threonyl-L-glutamine. Its seven residues are identical to positions 17 to 23 of thymosin β4, a 43-residue, N-terminally acetylated polypeptide that is one of the most abundant actin-monomer-binding proteins of vertebrate cells. The synthetic fragment carries an acetyl group on the α-amine of Leu^17 and a free carboxylic acid on Gln^23. The molecular formula is C38H68N10O14, the average molecular weight 889.0 g/mol and the monoisotopic mass 888.4916 Da. The peptide is registered under CAS number 885340-08-9 and as PubChem compound 62707662, whose synonyms include TB-500, TB 500 and the systematic peptide name given above; the Global Substance Registration System lists it under UNII QHK6Z47GTG. The full IUPAC name, (2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-acetamido-4-methylpentanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-carboxybutanoyl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoic acid, encodes nine stereocentres: the seven α-carbons (all S) and the two threonine β-carbons (both R). What the Name TB-500 Refers To "TB-500" is a trade name, not a systematic one, and it has been used for two different molecules: the short acetylated fragment described on this page, and synthetic full-length thymosin β4 (CAS 77591-33-4, PubChem CID 16132341, C212H350N56O78S, about 4963 g/mol, monoisotopic mass 4960.4863 Da). The two differ by a factor of about 5.6 in mass and are distinguished at a glance by mass spectrometry. In this catalog TB-500 means the heptapeptide, and the verified sequence of the lot on sale is shown in the product information box on this page. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/tb500

### Tesamorelin

- URL: https://cosmicpeptides.com/products/tesamorelin
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 218949-48-5
- Molecular formula: C221H366N72O67S
- Molecular weight: 5136.0
- Sequence: Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂
- Compound class: Synthetic 44-residue peptide amide; N-terminally acylated analogue of human GHRH(1–44)-NH2; class B1 G protein-coupled receptor agonist in vitro
- Sequence / structure: (E)-hex-3-enoyl-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 ; one-letter code YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL , with a trans -3-hexenoyl group on the Tyr^1 α-amine and a C-terminal carboxamide; all residues L-configured
- PubChem CID: 16137828
- Development code: TH9507 (Theratechnologies Inc.)
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | TSM10 | 26116 | 99.74% | 10.22 mg | $71.99 | yes |
| 5mg | — | 26113 | 99.7% | 5.25 mg | $45.99 | yes |

Tesamorelin is the trans -3-hexenoyl derivative of human growth hormone-releasing hormone 1–44 amide. It is a single linear polypeptide of 44 residues whose sequence is identical to the mature human GHRH 44-mer, carrying two features that are not encoded genetically: a C-terminal carboxamide in place of a free carboxylic acid, and a six-carbon unsaturated acyl group bonded to the α-amino group of the N-terminal tyrosine. Its molecular formula is C221H366N72O67S, its average molecular weight 5136.0 g/mol and its monoisotopic mass 5132.7166 Da; it is indexed as PubChem CID 16137828 under CAS registry number 218949-48-5, with 804475-66-9 circulating for the acetate salt. The development code TH9507 appears throughout the older literature. The parent hormone is the product of the gene GHRH , whose 108-residue precursor somatoliberin is catalogued as UniProtKB P01286. The mature 44-mer occupies residues 32–75 of that precursor, and the next residue, Gly^76, is the amide donor: peptidylglycine α-amidating monooxygenase converts the Leu-Gly pair into a C-terminal leucinamide, which is why both the natural hormone and this analogue end in -Arg-Leu-NH2 . GHRH was isolated and sequenced in 1982 by two groups independently, reported by Guillemin and co-workers in Science and by Rivier and colleagues in Nature ; the 44-residue amide is the longest naturally occurring form, while the 40-residue amide and the synthetic 1–29 amide retain receptor activity in vitro. In the numbering used here, residue 1 is the tyrosine bearing the acyl cap, and the hexenoyl group is a substituent on it rather than an extra residue, so tesamorelin is a 44-mer and not a 45-mer. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/tesamorelin

### Thymalin

- URL: https://cosmicpeptides.com/products/thymalin
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 63340-72-7
- Molecular formula: C33H54N12O15
- Molecular weight: 858.9
- Sequence: H-Pyr-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn-OH
- Compound class: Synthetic linear nonapeptide with an N-terminal pyroglutamyl residue and a free C-terminal acid; the sequence known in the literature as facteur thymique sérique (FTS), nonathymulin or, zinc-bound, thymulin. The name "thymalin" originally denotes a thymus-derived polypeptide mixture (see Molecular Identity).
- Sequence: Pyr-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn-OH (Pyr = pGlu, L-pyroglutamyl; one-letter code pEAKSQGGSN), all chiral residues L
- PubChem CID: 3085284
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 10mg | TY10 | 26075 | 99.8% | 10.11 mg | $34.99 | yes |

Several distinct materials share the vocabulary around thymalin, and only one of them is a single, chemically defined molecule. The defined nonapeptide. The material described by the formula, molecular weight and sequence on this page is pGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn-OH . Its PubChem IUPAC name, (2S)-4-amino-2-[[(2S)-2-[[2-[[2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-5-oxopyrrolidine-2-carbonyl]amino]propanoyl]amino]hexanoyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]-4-oxobutanoic acid, encodes seven stereocentres, all S. The formula is C33H54N12O15, the average molecular weight 858.86 g/mol and the monoisotopic mass 858.3832 Da. PubChem lists it as compound 3085284 under the names nonathymulin and thymic factor, CAS 63958-90-7, with "Thymalin" recorded as a synonym. The sequence was established in 1977 for a peptide isolated from serum by Jean-François Bach, Mireille Dardenne and Jean-Marie Pléau in Paris, who named it facteur thymique sérique (FTS, serum thymic factor). Edman analysis of the intact peptide and of tryptic fragments, with the C-terminal residue identified by carboxypeptidase A digestion, gave the sequence, and synthesis confirmed it. In 1982 the same group showed that activity in an in vitro rosette assay depended on bound zinc and named the zinc complex thymulin (FTS-Zn), reserving FTS or nonathymulin for the zinc-free peptide. The historical thymalin preparation. Thymalin in its original sense is a polypeptide complex obtained from calf thymus tissue by mild acid extraction, the preparation described under that name by Morozov and Khavinson. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/thymalin

### Thymosin Alpha-1

- URL: https://cosmicpeptides.com/products/thymosin-alpha-1
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 62304-98-7
- Molecular formula: C129H215N33O55
- Molecular weight: 3108.3
- Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH
- Compound class: Linear 28-residue polypeptide; N-terminally acetylated acidic peptide corresponding to residues 2–29 of prothymosin alpha
- Sequence: Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH (one-letter code, Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH), all chiral residues in the L-configuration
- PubChem CID: 16130571
- Defining modification: N^α-acetyl serine at position 1; the free C-terminus is an unmodified asparagine carboxylic acid
- Net charge and isoelectric point: Approximately −6 at pH 7.0; calculated pI about 3.8–4.1 depending on the pKa set (a strongly acidic peptide)
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | TA5 | 26088 | 99.7% | 5.48 mg | $42.99 | yes |
| 10mg | TA10 | — | — | — | $69.99 | no |

Thymosin alpha-1 (commonly abbreviated Tα1) is a single-chain polypeptide of 28 amino acid residues whose N-terminal serine carries an acetyl group on its α-amino nitrogen. Its full sequence is Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH , written in one-letter code as Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH. The molecular formula of the free peptide acid is C129H215N33O55, corresponding to an average molecular weight of 3108.3 g/mol and a monoisotopic mass of 3106.504 Da. It is registered under CAS number 62304-98-7 and catalogued as PubChem compound 16130571. The molecule is not an independent gene product. It corresponds to residues 2–29 of prothymosin alpha, a 111-residue intracellular acidic protein encoded by the PTMA gene (UniProt P06454). The initiator methionine is removed and the exposed serine is N^α-acetylated; counting from that serine (the convention of the processing literature, one less than the UniProt numbering), the peptide ends at Asn^28. Sarandeses and colleagues showed in 2003 that a lysosomal asparaginyl endopeptidase, identified as mammalian legumain, cleaves the Asn^28–Gly^29 and Asn^35–Gly^36 bonds of prothymosin alpha with similar efficiency in vitro, generating the 28- and 35-residue fragments thymosin alpha-1 and thymosin alpha-11. Numbering, acetylation state and the free C-terminal Asn all follow from the precursor. A frequent source of confusion is the relationship between thymosin alpha-1 and the beta-thymosins. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/thymosin-alpha-1

### VIP

- URL: https://cosmicpeptides.com/products/vip
- Type: Synthetic research peptide, lyophilized powder
- CAS number: 37221-79-7
- Molecular formula: C147H237N43O43S
- Molecular weight: 3326.8
- Sequence: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn
- Compound class: Linear 28-residue neuropeptide of the secretin/PACAP peptide family; endogenous agonist of the class B1 G protein-coupled receptors VPAC1 and VPAC2
- Sequence / structure: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn (one-letter code: HSDAVFTDNYTRLRKQMAVKKYLNSILN); the native peptide ends in a C-terminal asparagine amide (Asn-NH2)
- PubChem CID: 53314964 (CAS 37221-79-7); 16132300 (CAS 40077-57-4)
- Physical form as supplied: Lyophilized powder

| Size | SKU | Lot ID | Purity | Verified quantity | Price (USD) | In stock |
|---|---|---|---|---|---|---|
| 5mg | VP5 | — | — | — | $37.99 | no |
| 10mg | VP10 | 25046 | 99.8% | 10.08 mg | $59.99 | yes |

Vasoactive intestinal peptide (VIP) is a 28-amino-acid linear peptide with the sequence His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn. It was isolated by Sami Said and Viktor Mutt in 1970 from extracts of small intestine, purified by following its activity in the bioassays of the time, and its complete primary structure was reported by the same authors in 1974. The same 28-residue sequence is shared by many mammalian orthologues, which is why catalogues and chemical registries list it as a single compound. VIP belongs to the secretin/PACAP family of peptides, a group of structurally related regulatory peptides that includes pituitary adenylate cyclase-activating polypeptide (PACAP), peptide histidine methionine (PHM), secretin and growth hormone-releasing hormone (GHRH). The family is defined by a shared architecture: an N-terminal segment beginning with histidine (or a closely related residue) that is needed for receptor activation, followed by a long stretch with a strong tendency to form an amphipathic α-helix that provides most of the binding energy. The receptors of the family are class B1 (secretin-like) G protein-coupled receptors, and VIP is the prototypical ligand of two of them, VPAC1 and VPAC2. In the cell, VIP is cut from a larger precursor. Cloning of the precursor cDNA by Itoh and colleagues in 1983 showed that prepro-VIP encodes two bioactive peptides, VIP itself and PHM-27, separated by short spacer sequences and flanked by basic cleavage sites. VIP is released from the precursor as a glycine-extended intermediate, VIP-Gly, and the glycine is then converted into the C-terminal amide of Asn^28 by peptidylglycine α-amidating monooxygenase. (continued on the product page)

Full scientific monograph, certificate of analysis and live lot data: https://cosmicpeptides.com/products/vip

## Notice

All products are sold for in vitro laboratory research only. They are not drugs, foods, cosmetics or supplements, and they are not for human or veterinary use. Purchasers must be 21 or older and accept the research-use-only terms at https://cosmicpeptides.com/pages/terms-of-service.